Skip to main content

Table 1 Amino acid sequences and physicochemical properties of H1–H8

From: Design and pharmacodynamics of recombinant NZ2114 histidine mutants with improved activity against methicillin-resistant Staphylococcus aureus

Name Sequence Molecular weight (Da) PI Charge GRAVY Instability index: Boman index (kcal/mol)
NZ2114 GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY 4417.0 8.62 + 3 −0.672 25.49 1.52
NZ16K (H1) GFGCNGPWNEDDLRCKNHCKSIKGYKGGYCAKGGFVCKCY 4408.0 8.84 +4 −0.690 11.42 1.54
NZ16R (H2) GFGCNGPWNEDDLRCRNHCKSIKGYKGGYCAKGGFVCKCY 4436.0 8.86 +4 −0.705 14.51 1.77
NZ18K(H3) GFGCNGPWNEDDLRCHNKCKSIKGYKGGYCAKGGFVCKCY 4408.0 8.84 +4 −0.690 31.41 1.54
NZ18R (H4) GFGCNGPWNEDDLRCHNRCKSIKGYKGGYCAKGGFVCKCY 4436.0 8.86 +4 −0.705 25.49 1.77
NZ16K18K (H5) GFGCNGPWNEDDLRCKNKCKSIKGYKGGYCAKGGFVCKCY 4399.0 9.02 +5 −0.708 17.34 1.56
NZ16K18R(H6) GFGCNGPWNEDDLRCKNRCKSIKGYKGGYCAKGGFVCKCY 4427.1 9.04 +5 −0.722 11.42 1.79
NZ16R18K (H7) GFGCNGPWNEDDLRCRNKCKSIKGYKGGYCAKGGFVCKCY 4427.1 9.04 +5 −0.722 20.43 1.79
NZ16R18R (H8) GFGCNGPWNEDDLRCRNRCKSIKGYKGGYCAKGGFVCKCY 4455.1 9.06 +5 −0.738 4.51 2.03