Skip to main content

TableĀ 2 The information of motif found in MEME

From: Genome-wide identification of the fatty acid desaturases gene family in four Aspergillus species and their expression profile in Aspergillus oryzae

Motif Motif length Motif sequence
1 38 HVITALVTLGEGYHNFHHEFPSDYRNAIEWYQYDPTKW
2 21 IGWWKRSHRVHHRYTBTPEDD
3 42 GRGJIIIGDVVHDVTAFIKFHPGGKKSIKHMVGKDATDEFNG
4 50 ISHMVTAPLHVQITLSHFAMSTADLGVNESFPQKMLRTTMDVDCPTWLDF
5 50 WTVMIHDGEYLANSPVVNGAACHTMHHLYFNYNYGQFTTLWDRLGGSYRK