Skip to main content

Table 1 Signal peptides used in this study

From: Improving extracellular production of Serratia marcescens lytic polysaccharide monooxygenase CBP21 and Aeromonas veronii B565 chitinase Chi92 in Escherichia coli and their synergism

Name Amino acids sequence Origin References
WOmpA MKKTAIAIAVALAGFATVAQA↓APKD E. coli (Robbens et al. 2006)
OmpASIL2 (OmpAS) MKKTAIAIAVALAGFATVAQA↓SAPT E. coli (Robbens et al. 2006)
LM-SEA MKKTAFTLLLFIALTLTTSPLVNG E. coli (Manuvera et al. 2010)
LSEA-mut (LSEAM) MKKTAFTLLLFIALTWTTSPLASA E. coli (Manuvera et al. 2010)
StII MKKNIAFLLASMFVFSIATNAYA E. coli (Chang et al. 1987)
PelB MKYLLPTAAAGLLLLAAQPAMA Erwinia carotovora (Khushoo et al. 2005)
gIII MKKLLFAIPLVVPFYSHS   (Lee et al. 2001)
Endoxylanase signal peptide (Exyl) MFKFKKKFLVGLTAAFMSISMFSATASA Bacillus sp. (Choi et al. 2000)
SacB MNIKKFAKQATVLTFTTALLAGGATQAFA B. subtilis (Wang et al. 2014)
CBHI MYRKLAVISAFLATARAQS T. reesei (Zhong et al. 2011)
TorA MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQAATDA E. coli (Yang et al. 2009)
Xylanase C signal peptide (XCs) MQQDGTQQDRIKQSPAPLNGMSRRGFLGGAGTLALATASGLLLPGTAHA S. lividans (Miyazaki et al. 2013)