Skip to main content

Table 1 Amino acid sequence of centrocin 1 heavy chain (CEN1 HC-Br) and its synthetic fragments and analogues

From: Anti-infectious and anti-inflammatory effects of peptide fragments sequentially derived from the antimicrobial peptide centrocin 1 isolated from the green sea urchin, Strongylocentrotus droebachiensis

Peptide Sequence Net charge at pH = 7.0 Ratio hydrophobic/total residues
CEN1 HC-Br GW(Br)FKKTFHKVSHAVKSGIHAGQRGCSALGF + 5.2 53%
CEN1 HC GWFKKTFHKVSHAVKSGIHAGQRGCSALGF + 5.2 53%
CEN1 HC-Br (1–20) GW(Br)FKKTFHKVSHAVKSGIHA + 4.3 60%
CEN1 HC (1–20) GWFKKTFHKVSHAVKSGIHA + 4.3 60%
CEN1 HC (Ser) GWFKKTFHKVSHAVKSGIHAGQRGSSALGF + 5.3 50%